This is a working overview of Stability testing, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2025-10-08 and is reviewed periodically as new material appears.
Stability testing examines how temperature, humidity, light, and pH affect NMN over time. The compound is generally considered hygroscopic and may degrade faster in aqueous solution than in dry powder form. Phosphate esters can hydrolyze under strongly acidic or alkaline conditions, and elevated temperatures accelerate such reactions. For storage, sealed containers at low temperature with desiccant are typical laboratory practices. Stability-indicating methods should separate NMN from its degradation products, including nicotinamide and nicotinamide riboside, so that purity loss can be tracked accurately.
Quality control for NMN materials typically includes identity, assay, impurity, and residual solvent tests. Certificates of analysis may report HPLC purity, water content, heavy metals, and microbial limits depending on the intended use. Because commercial NMN is sold as a research chemical or ingredient rather than a standardized drug in many jurisdictions, specifications can vary between suppliers. Independent verification can involve comparing retention time, mass spectrum, and NMR data against a reference standard. Open questions remain about how best to standardize purity claims and biological potency across different production methods.
Analytical identification of NMN usually combines chromatographic separation with mass spectrometric detection. High-performance liquid chromatography coupled to tandem mass spectrometry is common for quantifying NMN in biological matrices and finished materials. Because NMN and related nucleotides share similar masses and retention behavior, method development must resolve potential interferences such as nicotinamide riboside and NAD+. Ultraviolet detection at approximately 260 nm can be used for purity checks when concentrations are sufficient. Nuclear magnetic resonance spectroscopy provides structural confirmation and can distinguish anomeric forms.
As a commercial ingredient, nicotinamide mononucleotide is commonly supplied as a powder or capsule. Its stability depends on temperature, moisture, pH, and light exposure. Hydrolytic and thermal degradation can increase over time, so manufacturers and laboratories often store material cold and dry. Purity is typically assessed with chromatographic methods, and identity can be confirmed by mass spectrometry. Published stability data for specific finished products remain limited. More data would help define shelf life under real-world conditions.
Regulatory treatment varies by country. In the United States, NMN has been marketed as a dietary supplement, but the Food and Drug Administration has stated that it is excluded from the dietary supplement definition because it was authorized for investigation as a new drug before being marketed as a supplement. Other jurisdictions may treat it as a novel food, a supplement, or an unapproved drug ingredient. Import and sale rules can therefore differ substantially.
Quality control for NMN focuses on identity, purity, residual solvents, heavy metals, and microbial limits. Because the molecule can absorb water, moisture content and packaging are relevant to shelf life. Suppliers may provide certificates of analysis, but independent verification is often needed for research or commercial use. The long-term stability of different crystal forms, salt forms, and formulations is not fully characterized in the public literature. Some degradation products and their effects on product performance remain open questions.
| Property | Value | Notes |
|---|---|---|
| Common analytical method | HPLC-UV or LC-MS/MS | LC-MS/MS offers higher sensitivity for complex matrices. |
| Typical purity specification | ≥95% by HPLC | Values vary by supplier and product grade. |
| Storage temperature | −20 °C or lower | Desiccated and protected from light; avoid repeated warming. |
| Water solubility | Soluble | Aqueous solutions may be acidic and should be prepared fresh when possible. |
| Common synonyms | Nicotinamide mononucleotide; β-NMN | The β anomer is the naturally occurring form. |
Identity and purity are usually assessed with complementary methods. Nuclear magnetic resonance spectroscopy can confirm the molecular structure and distinguish anomeric forms. High-performance liquid chromatography with ultraviolet detection or mass spectrometry is common for assay and related-substance testing. Mass spectrometry also supports trace quantification in biological samples, often with isotope-labeled internal standards. Because NMN lacks a strong chromophore, some ultraviolet methods require careful wavelength selection or derivatization, and laboratories may validate each approach for its intended matrix.
Commercial NMN is produced through enzymatic or chemical routes, and the resulting material can vary in purity, counterion, and residual solvent content. Buyers typically rely on certificates of analysis, but independent verification through third-party laboratories provides stronger assurance. Regulatory treatment differs by country; in the United States, NMN has been subject to shifting guidance about its status as a dietary supplement, while other markets permit sales under local rules. No universal pharmacopeial monograph exists for NMN, so specifications often come from suppliers, research protocols, or regional requirements.
Solid NMN is generally handled as a moisture-sensitive compound. Dry material stored desiccated at low temperature, protected from light, tends to remain stable for extended periods. Aqueous solutions are less stable and can undergo hydrolysis, especially at elevated temperature or alkaline pH. The anomeric form also matters: beta-NMN is the naturally occurring form, while alpha-NMN can appear as a synthetic impurity. Purity and storage conditions therefore influence both analytical results and experimental reproducibility.
Solid NMN is a polar, water-soluble nucleotide that can absorb moisture from air. Its phosphate ester is susceptible to hydrolysis, and degradation is faster in aqueous solution, under strongly acidic or alkaline conditions, and at elevated temperatures. For laboratory and commercial handling, the solid is typically kept desiccated, protected from light, and stored frozen. Repeated freeze-thaw cycles can introduce moisture and accelerate breakdown. Stability data for specific formulations should be generated rather than assumed from the parent compound.
Identity and purity of NMN are commonly assessed by liquid chromatography with ultraviolet detection or mass spectrometry. High-performance liquid chromatography can separate related impurities such as nicotinamide, nicotinamide riboside, and NAD+ depending on the method. Mass spectrometry provides molecular mass confirmation, while nuclear magnetic resonance spectroscopy helps establish structure and anomeric form. Quantitative assays often use calibration curves and, in biological samples, stable isotope-labeled internal standards. Method validation addresses specificity, linearity, accuracy, precision, and limits of detection.
Quality control for NMN materials typically includes appearance, assay, impurity profile, residual solvents, heavy metals, and microbial limits. A certificate of analysis summarizes specified tests, but the underlying methods and laboratory accreditation matter. Regulatory treatment varies by country; NMN is sold as a dietary supplement in some markets, while other jurisdictions restrict its use in foods or classify it differently. Independent verification can reduce risks of mislabeling or substitution. Questions remain about how product purity, storage history, and formulation affect delivered dose in humans.
Quantifying NMN requires methods that separate it from structurally similar compounds such as nicotinamide, nicotinamide riboside, and NAD+. Common approaches include high-performance liquid chromatography coupled with ultraviolet detection, liquid chromatography with tandem mass spectrometry, capillary electrophoresis, and nuclear magnetic resonance for identity confirmation. Because NMN is polar and often present at low concentrations in biological samples, sample preparation can involve protein precipitation, solid-phase extraction, or derivatization. Isotope-labeled internal standards help correct for matrix effects and recovery losses. Reported concentrations depend heavily on the matrix, extraction protocol, and analytical platform.
Stability of NMN depends on physical form, temperature, moisture, light, and pH. The solid compound is generally more stable than aqueous solutions, which can degrade over time, especially when warm or exposed to extreme pH. Recommended laboratory storage is typically desiccated at −20 °C or below, protected from light, with containers sealed to limit moisture uptake. In solution, degradation products may include nicotinamide and related ribosides, and the rate varies with buffer composition and concentration. Analytical laboratories often prepare fresh solutions and validate stability for each method.
Quality control for NMN materials usually covers identity, assay purity, residual solvents, heavy metals, microbial limits, and moisture content. Certificates of analysis from suppliers may report high-performance liquid chromatography purity, mass spectrometry identity, and elemental impurity testing. Regulatory treatment differs by country: NMN is not an approved drug, and its status as a dietary supplement ingredient or novel food has been debated. Some authorities have restricted sales pending safety and regulatory review, while others allow it under specific categories. Buyers should verify documentation rather than rely on label claims.
Despite the health risks in certain cases, the nut-like kernels of the seeds are esteemed in Asia and are a traditional ingredient in Chinese food. Ginkgo nuts are used in congee, and are often served at special occasions such as weddings and the Chinese New Year (as part of the vegetarian dish called Buddha's delight). Japanese cooks add ginkgo seeds (called ginnan) to dishes such as chawanmushi, and cooked seeds are often eaten along with other dishes. Grilled ginkgo nuts with salt are also a popular item at izakayas as a snack with beer and other Japanese food. In Korea, ginkgo nuts are stir-fried and eaten, or are used to garnish foods such as sinseonro.
This method, pharmacophore-similarity-based QSAR (PS-QSAR) uses topological pharmacophoric descriptors to develop QSAR models. This activity prediction may assist the contribution of certain pharmacophore features encoded by respective fragments toward activity improvement and/or detrimental effects.
Polymers are chemical compounds made up of a large number of identical components linked together like chains. Polymers are the raw materials (the resins) used to make what are commonly called plastics and rubber. Plastics and rubber are the final product, created after one or more polymers or additives have been added to a resin during processing, which is then shaped into a final form. Plastics in former and in current widespread use include polyethylene, polypropylene, polyvinyl chloride (PVC), polystyrene, nylons, polyesters, acrylics, polyurethanes, and polycarbonates. Rubbers include natural rubber, styrene-butadiene rubber, chloroprene, and butadiene rubber. Plastics are generally classified as commodity, specialty and engineering plastics. Polyvinyl chloride (PVC) is widely used, inexpensive, and annual production quantities are large. It lends itself to a vast array of applications, from artificial leather to electrical insulation and cabling, packaging, and containers. Its fabrication and processing are simple and well-established. The versatility of PVC is due to the wide range of plasticisers and other additives that it accepts. The term "additives" in polymer science refers to the chemicals and compounds added to the polymer base to modify its material properties. Polycarbonate would be normally considered an engineering plastic (other examples include PEEK, ABS). Such plastics are valued for their superior strengths and other special material properties. They are usually not used for disposable applications, unlike commodity plastics.
Sources: en.wikipedia.org
== Side effects == Possible side effects of olanzapine/fluoxetine include all those of the two component drugs: olanzapine (side effects) and fluoxetine (side effects). Common side effects include suicidal thoughts, increased appetite, weight gain, drowsiness, fatigue, dry mouth, swelling, tremor, blurred vision, and difficulty concentrating. Olanzapine/fluoxetine could produce a severe allergic reaction and should not be used if the patient has previously experienced an allergic reaction to either fluoxetine or olanzapine. Olanzapine is correlated with an increase in blood sugar. Patients with diabetes, or those at risk for developing it, require careful monitoring. In rare cases, olanzapine/fluoxetine may cause neuroleptic malignant syndrome. Like other SSRIs, olanzapine/fluoxetine carries a boxed warning stating that it could increase the risk of suicidal thoughts and behaviors in patients aged 24 and under. The warning also states that olanzapine/fluoxetine may increase the risk of death in elderly patients with dementia-related psychosis.
== History == Dantrolene was first described in the scientific literature in 1967, as one of several hydantoin derivatives proposed as a new class of muscle relaxant. Dantrolene underwent extensive further development, and its action on skeletal muscle was described in detail in 1973. Dantrolene was widely used in the management of spasticity before its efficacy in treating malignant hyperthermia was discovered by South African anesthesiologist Gaisford Harrison and reported in a landmark 1975 article published in the British Journal of Anaesthesia. Harrison experimentally induced malignant hyperthermia with halothane anesthesia in genetically susceptible pigs, and obtained an 87.5% survival rate, where seven of his eight experiments survived after intravenous administration of dantrolene. The efficacy of dantrolene in humans was later confirmed in a large, multicenter study published in 1982, and confirmed epidemiologically in 1993. Before dantrolene, the only available treatment for malignant hyperthermia was either procainamide or procaine, the latter being associated with a 60% mortality rate in animal models.
==== Microanatomy ==== Serotonin is released into the synapse, or space between neurons, and diffuses over a relatively wide gap (>20 nm) to activate 5-HT receptors located on the dendrites, cell bodies, and presynaptic terminals of adjacent neurons. When humans smell food, dopamine is released to increase the appetite. But, unlike in worms, serotonin does not increase anticipatory behaviour in humans; instead, the serotonin released while consuming activates 5-HT2C receptors on dopamine-producing cells. This halts their dopamine release, and thereby serotonin decreases appetite. Drugs that block 5-HT2C receptors make the body unable to recognize when it is no longer hungry or otherwise in need of nutrients, and are associated with weight gain, especially in people with a low number of receptors. The expression of 5-HT2C receptors in the hippocampus follows a diurnal rhythm, just as the serotonin release in the ventromedial nucleus, which is characterised by a peak at morning when the motivation to eat is strongest. In macaques, alpha males have twice the level of serotonin in the brain as subordinate males and females (measured by the concentration of 5-HIAA in the cerebrospinal fluid (CSF)). Dominance status and CSF serotonin levels appear to be positively correlated. When dominant males were removed from such groups, subordinate males begin competing for dominance. Once new dominance hierarchies were established, serotonin levels of the new dominant individuals also increased to double those in subordinate males and females.
=== Later career === During World War II, Mester worked as a surgeon at Saint John's Hospital and in the "Rock Hospital", located in the tunnels underneath Castle Hill in Budapest. Mester chaired the Surgery Department of the Bajcsy Zsilinszky Teaching Hospital in Budapest from 1947 until 1963. He publicly welcomed the 1956 Hungarian uprising against Communism yet, when it failed, he was not persecuted because of his important medical work. In 1963, he became Professor and Department Chair at the Semmelweis Medical University in Budapest, and worked there until his retirement in 1973. In 1971, he received the "Doctor of Sciences" title from the Hungarian Academy of Sciences.
Sources: en.wikipedia.org
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Used since ancient times as a method of staining glass, colloidal gold was used in the 4th-century Lycurgus Cup, which changes color depending on the location of light source. During the Middle Ages, soluble gold, a solution containing gold salt, had a reputation for its curative property for various diseases. In 1618, Francis Anthony, a philosopher and member of the medical profession, published a book called Panacea Aurea, sive tractatus duo de ipsius Auro Potabili (Latin: gold potion, or two treatments of potable gold). The book introduces information on the formation of colloidal gold and its medical uses. About half a century later, English botanist Nicholas Culpepper published a book in 1656, Treatise of Aurum Potabile, solely discussing the medical uses of colloidal gold. In 1676, Johann Kunckel, a German chemist, published a book on the manufacture of stained glass. In his book Valuable Observations or Remarks About the Fixed and Volatile Salts-Auro and Argento Potabile, Spiritu Mundi and the Like, Kunckel assumed that the pink color of Aurum Potabile came from small particles of metallic gold, not visible to human eyes. In 1842, John Herschel invented a photographic process called chrysotype (from the Greek χρῡσός meaning "gold") that used colloidal gold to record images on paper. Modern scientific evaluation of colloidal gold did not begin until Michael Faraday's work in the 1850s. In 1856, in a basement laboratory of Royal Institution, Faraday accidentally created a ruby red solution while mounting pieces of gold leaf onto microscope slides.
6'-deoxychalcone synthase (EC 2.3.1.170) is an enzyme that catalyzes the synthesis of the polyketide, isoliquiritigenin, from one unit of coumaroyl-CoA and three of malonyl-CoA. The enzyme requires reduced nicotinamide adenine dinucleotide phosphate (NADPH) to activate its substrate. It is present in Glycyrrhiza echinata (Russian licorice) and other leguminous plants, where it is part of the pathway to phytoalexins such as the flavanone, liquiritigenin.
Sources: en.wikipedia.org
Common methods include HPLC with ultraviolet detection and LC-MS/MS. These techniques separate NMN from related nucleotides and quantify it by retention time and mass-to-charge ratio.
Low temperature and low moisture slow hydrolysis and other degradation reactions. Desiccants and sealed containers reduce exposure to water vapor and oxygen.
It typically reports identity, purity, water content, and selected impurities. The exact panel depends on the supplier, product grade, and intended application.
Laboratory samples are often kept cool, dry, and protected from light, with frozen storage used for longer periods. Finished products should follow label instructions and avoid excessive heat or moisture.